Lineage for d5m3dd1 (5m3d D:114-201)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016220Fold a.135: Tetraspanin [48651] (1 superfamily)
    5 helices: irregular disulfide-linked array; form homodimer
  4. 2016221Superfamily a.135.1: Tetraspanin [48652] (1 family) (S)
  5. 2016222Family a.135.1.1: Tetraspanin [48653] (2 proteins)
  6. 2016229Protein automated matches [256548] (3 species)
    not a true protein
  7. 2016232Species Human (Homo sapiens) [TaxId:9606] [256549] (11 PDB entries)
  8. 2016255Domain d5m3dd1: 5m3d D:114-201 [327205]
    Other proteins in same PDB: d5m3da2, d5m3db2, d5m3dc2, d5m3dd2
    automated match to d1g8qa_
    complexed with edo, po4

Details for d5m3dd1

PDB Entry: 5m3d (more details), 2.38 Å

PDB Description: structural tuning of cd81lel (space group p31)
PDB Compounds: (D:) CD81 antigen

SCOPe Domain Sequences for d5m3dd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m3dd1 a.135.1.1 (D:114-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vnkdqiakdvkqfydqalqqavvdddannakavvktfhetldccgsstltalttsvlknn
lcpsgsniisnlfkedchqkiddlfsgk

SCOPe Domain Coordinates for d5m3dd1:

Click to download the PDB-style file with coordinates for d5m3dd1.
(The format of our PDB-style files is described here.)

Timeline for d5m3dd1: