SCOPe 2.08: Domain d5hrra_: 5hrr A:

Lineage for d5hrra_ (5hrr A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
   Pfam PF00665

6. Protein Retroviral integrase, catalytic domain [53108] (5 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (74 PDB entries)

8. Domain d5hrra_: 5hrr A: [327195]
   automated match to d3vq9c_
   protein/DNA complex; complexed with 65p, cac, edo, so4; mutant

Details for d5hrra_

PDB Entry: 5hrr, 1.88 Å

PDB Description: hiv integrase catalytic domain containing f185k + a124n + t125s mutations complexed with gsk0002

PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d5hrra_:

Sequence, based on SEQRES records:

>d5hrra_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktiht
dngsnftsnsvkaacwwagikqefgipynpqsqgvvesmnkelkkiigqvrdqaehlkta
vqmavfihnkkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records):

>d5hrra_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktiht
dngsnftsnsvkaacwwagikqegvvesmnkelkkiigqvrdqaehlktavqmavfihnk
krkgysagerivdiiatdiq

Timeline for d5hrra_:

• d5hrra_ first appeared in SCOPe 2.06
  
• d5hrra_ appears in SCOPe 2.07