Class b: All beta proteins [48724] (180 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.0: automated matches [191644] (1 protein) not a true family |
Protein automated matches [191182] (20 species) not a true protein |
Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [327115] (1 PDB entry) |
Domain d5f9kc1: 5f9k C:5-128 [327192] Other proteins in same PDB: d5f9ka2, d5f9kb2, d5f9kc2 automated match to d4oopb_ complexed with dup, mg, so4 |
PDB Entry: 5f9k (more details), 2.18 Å
SCOPe Domain Sequences for d5f9kc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f9kc1 b.85.4.0 (C:5-128) automated matches {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} fkvkklsdkaiipqrgskgaagydlssahelvvpahgkalamtdlqiaipdgtygriapr sglawknfidcgagvidsdyrgnvgvvlfnhsdvdfkvavgdrvaqliferivtpeplev deid
Timeline for d5f9kc1:
View in 3D Domains from other chains: (mouse over for more information) d5f9ka1, d5f9ka2, d5f9kb1, d5f9kb2 |