Lineage for d2trxa_ (2trx A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24117Family c.47.1.1: Thioltransferase [52834] (2 proteins)
  6. 24138Protein Thioredoxin [52835] (7 species)
  7. 24146Species Escherichia coli [TaxId:562] [52836] (9 PDB entries)
  8. 24147Domain d2trxa_: 2trx A: [32719]

Details for d2trxa_

PDB Entry: 2trx (more details), 1.68 Å

PDB Description: crystal structure of thioredoxin from escherichia coli at 1.68 angstroms resolution

SCOP Domain Sequences for d2trxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli}
sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkefldanla

SCOP Domain Coordinates for d2trxa_:

Click to download the PDB-style file with coordinates for d2trxa_.
(The format of our PDB-style files is described here.)

Timeline for d2trxa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2trxb_