Lineage for d5gn8a_ (5gn8 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1988415Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. 1989355Protein automated matches [190041] (27 species)
    not a true protein
  7. 1989604Species Human (Homo sapiens) [TaxId:9606] [187027] (24 PDB entries)
  8. 2283888Domain d5gn8a_: 5gn8 A: [327189]
    automated match to d3ajoa_
    complexed with ca

Details for d5gn8a_

PDB Entry: 5gn8 (more details), 2.81 Å

PDB Description: structure of a 48-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign
PDB Compounds: (A:) ferritin heavy chain

SCOPe Domain Sequences for d5gn8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gn8a_ a.25.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerehaekl
mklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklatdkndphl
cdfiethylikelgdhvtnlrkmgapesglaeylfdkhtlgd

SCOPe Domain Coordinates for d5gn8a_:

Click to download the PDB-style file with coordinates for d5gn8a_.
(The format of our PDB-style files is described here.)

Timeline for d5gn8a_:

  • d5gn8a_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-15