SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gn8a_ (5gn8 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1988415Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. 1989355Protein automated matches [190041] (26 species)
    not a true protein
  7. 1989604Species Human (Homo sapiens) [TaxId:9606] [187027] (21 PDB entries)
  8. 2283888Domain d5gn8a_: 5gn8 A: [327189]
    automated match to d3ajoa_
    complexed with ca

Details for d5gn8a_

PDB Entry: 5gn8 (more details), 2.81 Å

PDB Description: structure of a 48-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign
PDB Compounds: (A:) ferritin heavy chain

SCOPe Domain Sequences for d5gn8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gn8a_ a.25.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerehaekl
mklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklatdkndphl
cdfiethylikelgdhvtnlrkmgapesglaeylfdkhtlgd

SCOPe Domain Coordinates for d5gn8a_:

Click to download the PDB-style file with coordinates for d5gn8a_.
(The format of our PDB-style files is described here.)

Timeline for d5gn8a_:

  • d5gn8a_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-15