![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 protein domains) |
![]() | Protein automated matches [190041] (28 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187027] (25 PDB entries) |
![]() | Domain d5gn8a_: 5gn8 A: [327189] automated match to d3ajoa_ complexed with ca |
PDB Entry: 5gn8 (more details), 2.81 Å
SCOPe Domain Sequences for d5gn8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gn8a_ a.25.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerehaekl mklqnqrggriflqdikkpdcddwesglnamecalhleknvnqsllelhklatdkndphl cdfiethylikelgdhvtnlrkmgapesglaeylfdkhtlgd
Timeline for d5gn8a_: