Lineage for d5kpqb2 (5kpq B:797-1011)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208074Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2208075Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2208361Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2208362Protein automated matches [191197] (9 species)
    not a true protein
  7. 2208398Species Human (Homo sapiens) [TaxId:9606] [225406] (38 PDB entries)
  8. 2283887Domain d5kpqb2: 5kpq B:797-1011 [327188]
    Other proteins in same PDB: d5kpqa1, d5kpqb1
    automated match to d4hhyd2
    complexed with 6x2

Details for d5kpqb2

PDB Entry: 5kpq (more details), 2.55 Å

PDB Description: structure of human parp1 catalytic domain bound to a quinazoline-2, 4(1h,3h)-dione inhibitor
PDB Compounds: (B:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d5kpqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kpqb2 d.166.1.0 (B:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkt

SCOPe Domain Coordinates for d5kpqb2:

Click to download the PDB-style file with coordinates for d5kpqb2.
(The format of our PDB-style files is described here.)

Timeline for d5kpqb2:

  • d5kpqb2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5kpqb1