Lineage for d5kpqb1 (5kpq B:662-796)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996130Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 1996131Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 1996156Family a.41.1.0: automated matches [227223] (1 protein)
    not a true family
  6. 1996157Protein automated matches [226964] (1 species)
    not a true protein
  7. 1996158Species Human (Homo sapiens) [TaxId:9606] [225405] (44 PDB entries)
  8. 2283886Domain d5kpqb1: 5kpq B:662-796 [327187]
    Other proteins in same PDB: d5kpqa2, d5kpqb2
    automated match to d4hhyd1
    complexed with 6x2

Details for d5kpqb1

PDB Entry: 5kpq (more details), 2.55 Å

PDB Description: structure of human parp1 catalytic domain bound to a quinazoline-2, 4(1h,3h)-dione inhibitor
PDB Compounds: (B:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d5kpqb1:

Sequence, based on SEQRES records: (download)

>d5kpqb1 a.41.1.0 (B:662-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrgg
sddsskdpidvnyek

Sequence, based on observed residues (ATOM records): (download)

>d5kpqb1 a.41.1.0 (B:662-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgsdsqildlsnrfytliphdfgmkkppllnnadsvqakaemldnlldievaysllrggs
ddsskdpidvnyek

SCOPe Domain Coordinates for d5kpqb1:

Click to download the PDB-style file with coordinates for d5kpqb1.
(The format of our PDB-style files is described here.)

Timeline for d5kpqb1:

  • d5kpqb1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5kpqb2