SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lkrb_ (5lkr B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (79 species)
    not a true protein
  7. 2136259Species Human (Homo sapiens) [TaxId:9606] [188340] (66 PDB entries)
  8. 2283883Domain d5lkrb_: 5lkr B: [327184]
    automated match to d1maac_
    complexed with 6yc, fuc, ful, gol, nag, peg

Details for d5lkrb_

PDB Entry: 5lkr (more details), 2.52 Å

PDB Description: human butyrylcholinesterase complexed with n-propargyliperidines
PDB Compounds: (B:) cholinesterase

SCOPe Domain Sequences for d5lkrb_:

Sequence, based on SEQRES records: (download)

>d5lkrb_ c.69.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iiiatkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatkyan
sccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqtgts
slhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqknia
afggnpksvtlfgesagaasvslhllspgshslftrailqsgsfnapwavtslyearnrt
lnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfltdmp
dillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgvse
fgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyyfeh
rssklpwpewmgvmhgyeiefvfglplerrdnytkaeeilsrsivkrwanfakygnpnet
qnnstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkvl

Sequence, based on observed residues (ATOM records): (download)

>d5lkrb_ c.69.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iiiatkngkvrgmnltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatkyan
sccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqtgts
slhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqknia
afggnpksvtlfgesagaasvslhllspgshslftrailqsgsfnapwavtslyearnrt
lnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfltdmp
dillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgvse
fgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyyfeh
rssklpwpewmgvmhgyeiefvfglplerrdnytkaeeilsrsivkrwanfakygnpnet
qstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkvl

SCOPe Domain Coordinates for d5lkrb_:

Click to download the PDB-style file with coordinates for d5lkrb_.
(The format of our PDB-style files is described here.)

Timeline for d5lkrb_:

  • d5lkrb_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-15