Lineage for d5hz9a1 (5hz9 A:1-133)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062521Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2062522Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2063049Family b.60.1.2: Fatty acid binding protein-like [50847] (18 protein domains)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2063295Protein Muscle fatty acid binding protein (m-fabp) [50848] (2 species)
  7. 2063298Species Human (Homo sapiens) [TaxId:9606] [50849] (19 PDB entries)
  8. 2283879Domain d5hz9a1: 5hz9 A:1-133 [327180]
    Other proteins in same PDB: d5hz9a2, d5hz9b2, d5hz9c2, d5hz9d2, d5hz9e2, d5hz9f2, d5hz9g2, d5hz9h2
    automated match to d3wvma_
    complexed with 5m8, cl, so4

Details for d5hz9a1

PDB Entry: 5hz9 (more details), 2.3 Å

PDB Description: human fabp3 in complex with 6-chloro-2-methyl-4-phenyl-quinoline-3- carboxylic acid
PDB Compounds: (A:) Fatty acid-binding protein, heart

SCOPe Domain Sequences for d5hz9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hz9a1 b.60.1.2 (A:1-133) Muscle fatty acid binding protein (m-fabp) {Human (Homo sapiens) [TaxId: 9606]}
mvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfkn
teisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlth
gtavctrtyekea

SCOPe Domain Coordinates for d5hz9a1:

Click to download the PDB-style file with coordinates for d5hz9a1.
(The format of our PDB-style files is described here.)

Timeline for d5hz9a1:

  • d5hz9a1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15