Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein Muscle fatty acid binding protein (m-fabp) [50848] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50849] (22 PDB entries) |
Domain d5hz9a1: 5hz9 A:1-133 [327180] Other proteins in same PDB: d5hz9a2, d5hz9b2, d5hz9c2, d5hz9d2, d5hz9e2, d5hz9f2, d5hz9g2, d5hz9h2 automated match to d3wvma_ complexed with 5m8, cl, so4 |
PDB Entry: 5hz9 (more details), 2.3 Å
SCOPe Domain Sequences for d5hz9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hz9a1 b.60.1.2 (A:1-133) Muscle fatty acid binding protein (m-fabp) {Human (Homo sapiens) [TaxId: 9606]} mvdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfkn teisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlth gtavctrtyekea
Timeline for d5hz9a1: