SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h4ib_ (5h4i B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2057706Family b.47.1.3: Viral proteases [50596] (5 protein domains)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 2057796Protein automated matches [190658] (6 species)
    not a true protein
  7. 2283828Species Zika virus [TaxId:64320] [327129] (2 PDB entries)
  8. 2283874Domain d5h4ib_: 5h4i B: [327175]
    Other proteins in same PDB: d5h4ia_
    automated match to d3e90b_
    complexed with 7hq, act

Details for d5h4ib_

PDB Entry: 5h4i (more details), 2 Å

PDB Description: unlinked ns2b-ns3 protease from zika virus in complex with a compound fragment
PDB Compounds: (B:) NS3 protease

SCOPe Domain Sequences for d5h4ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h4ib_ b.47.1.3 (B:) automated matches {Zika virus [TaxId: 64320]}
ettdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdl
vsycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsg
spildkcgrviglygngvvikngsyvsaitqgkre

SCOPe Domain Coordinates for d5h4ib_:

Click to download the PDB-style file with coordinates for d5h4ib_.
(The format of our PDB-style files is described here.)

Timeline for d5h4ib_:

  • d5h4ib_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-15