Lineage for d5j26b_ (5j26 B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2158220Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2158221Family d.15.1.1: Ubiquitin-related [54237] (39 protein domains)
    Pfam PF00240
  6. 2158943Protein automated matches [190118] (11 species)
    not a true protein
  7. 2158968Species Human (Homo sapiens) [TaxId:9606] [189560] (92 PDB entries)
  8. 2283873Domain d5j26b_: 5j26 B: [327174]
    Other proteins in same PDB: d5j26a1, d5j26a2
    automated match to d4k1rb_

Details for d5j26b_

PDB Entry: 5j26 (more details), 2.5 Å

PDB Description: crystal structure of a 53bp1 tudor domain in complex with a ubiquitin variant
PDB Compounds: (B:) Ubiquitin Variant i53

SCOPe Domain Sequences for d5j26b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j26b_ d.15.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amlifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagksledgrtlsdy
nilkdsklhpllrlrg

SCOPe Domain Coordinates for d5j26b_:

Click to download the PDB-style file with coordinates for d5j26b_.
(The format of our PDB-style files is described here.)

Timeline for d5j26b_:

  • d5j26b_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-15