SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5j26b_ (5j26 B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2158220Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2158221Family d.15.1.1: Ubiquitin-related [54237] (39 protein domains)
    Pfam PF00240
  6. 2158943Protein automated matches [190118] (10 species)
    not a true protein
  7. 2158968Species Human (Homo sapiens) [TaxId:9606] [189560] (85 PDB entries)
  8. 2283873Domain d5j26b_: 5j26 B: [327174]
    Other proteins in same PDB: d5j26a1, d5j26a2
    automated match to d4k1rb_

Details for d5j26b_

PDB Entry: 5j26 (more details), 2.5 Å

PDB Description: crystal structure of a 53bp1 tudor domain in complex with a ubiquitin variant
PDB Compounds: (B:) Ubiquitin Variant i53

SCOPe Domain Sequences for d5j26b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j26b_ d.15.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amlifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagksledgrtlsdy
nilkdsklhpllrlrg

SCOPe Domain Coordinates for d5j26b_:

Click to download the PDB-style file with coordinates for d5j26b_.
(The format of our PDB-style files is described here.)

Timeline for d5j26b_:

  • d5j26b_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-15