Lineage for d5i0ra_ (5i0r A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2815005Family b.82.1.19: Cysteine dioxygenase type I [141615] (2 proteins)
    Pfam PF05995, CDO_I
  6. 2815006Protein Cysteine dioxygenase type I [141616] (4 species)
  7. 2815026Species Norway rat (Rattus norvegicus) [TaxId:10116] [159291] (55 PDB entries)
  8. 2815047Domain d5i0ra_: 5i0r A: [327171]
    automated match to d3elna_
    complexed with cl, dcy, fe; mutant

Details for d5i0ra_

PDB Entry: 5i0r (more details), 1.35 Å

PDB Description: d-cysteine bound c93a mutant of cysteine dioxygenase at ph 8
PDB Compounds: (A:) Cysteine dioxygenase type 1

SCOPe Domain Sequences for d5i0ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i0ra_ b.82.1.19 (A:) Cysteine dioxygenase type I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvd
qgngkfnlmilcwgeghgssihdhtdshaflkllqgnlketlfdwpdkksnemikksert
lrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhsk
fgirtp

SCOPe Domain Coordinates for d5i0ra_:

Click to download the PDB-style file with coordinates for d5i0ra_.
(The format of our PDB-style files is described here.)

Timeline for d5i0ra_: