SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h4ia_ (5h4i A:)

  1. Root: SCOPe 2.06
  2. 2229111Class g: Small proteins [56992] (94 folds)
  3. 2237459Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily)
  4. 2237460Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families) (S)
    Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex
  5. 2281084Family g.96.1.0: automated matches [324385] (1 protein)
    not a true family
  6. 2281085Protein automated matches [324386] (2 species)
    not a true protein
  7. 2283836Species Zika virus [TaxId:64320] [327137] (3 PDB entries)
  8. 2283862Domain d5h4ia_: 5h4i A: [327163]
    Other proteins in same PDB: d5h4ib_
    automated match to d2ggva_
    complexed with 7hq, act

Details for d5h4ia_

PDB Entry: 5h4i (more details), 2 Å

PDB Description: unlinked ns2b-ns3 protease from zika virus in complex with a compound fragment
PDB Compounds: (A:) NS2B cofactor

SCOPe Domain Sequences for d5h4ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h4ia_ g.96.1.0 (A:) automated matches {Zika virus [TaxId: 64320]}
dmyieragditwekdaevtgnsprldvaldesgdfslv

SCOPe Domain Coordinates for d5h4ia_:

Click to download the PDB-style file with coordinates for d5h4ia_.
(The format of our PDB-style files is described here.)

Timeline for d5h4ia_:

  • d5h4ia_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-15