Lineage for d5j26a2 (5j26 A:1538-1603)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2047114Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2047115Family b.34.9.1: Tudor domain [63749] (8 protein domains)
    Pfam PF00567
  6. 2047149Protein p53-binding protein 1, 53BP1 [110163] (1 species)
    duplication; contains two Tudor domains in tandem
  7. 2047150Species Human (Homo sapiens) [TaxId:9606] [110164] (7 PDB entries)
    Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606
  8. 2283856Domain d5j26a2: 5j26 A:1538-1603 [327157]
    Other proteins in same PDB: d5j26b_
    automated match to d1ssfa2

Details for d5j26a2

PDB Entry: 5j26 (more details), 2.5 Å

PDB Description: crystal structure of a 53bp1 tudor domain in complex with a ubiquitin variant
PDB Compounds: (A:) tumor suppressor p53-binding protein 1

SCOPe Domain Sequences for d5j26a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j26a2 b.34.9.1 (A:1538-1603) p53-binding protein 1, 53BP1 {Human (Homo sapiens) [TaxId: 9606]}
ipldtevtalsedeyfsagvvkghrkesgelyysiekegqrkwykrmavilsleqgnrlr
eqyglg

SCOPe Domain Coordinates for d5j26a2:

Click to download the PDB-style file with coordinates for d5j26a2.
(The format of our PDB-style files is described here.)

Timeline for d5j26a2:

  • d5j26a2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5j26a1
View in 3D
Domains from other chains:
(mouse over for more information)
d5j26b_