SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5j26a1 (5j26 A:1487-1537)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2047114Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2047115Family b.34.9.1: Tudor domain [63749] (8 protein domains)
    Pfam PF00567
  6. 2047149Protein p53-binding protein 1, 53BP1 [110163] (1 species)
    duplication; contains two Tudor domains in tandem
  7. 2047150Species Human (Homo sapiens) [TaxId:9606] [110164] (7 PDB entries)
    Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606
  8. 2283855Domain d5j26a1: 5j26 A:1487-1537 [327156]
    Other proteins in same PDB: d5j26b_
    automated match to d2lvma1

Details for d5j26a1

PDB Entry: 5j26 (more details), 2.5 Å

PDB Description: crystal structure of a 53bp1 tudor domain in complex with a ubiquitin variant
PDB Compounds: (A:) tumor suppressor p53-binding protein 1

SCOPe Domain Sequences for d5j26a1:

Sequence, based on SEQRES records: (download)

>d5j26a1 b.34.9.1 (A:1487-1537) p53-binding protein 1, 53BP1 {Human (Homo sapiens) [TaxId: 9606]}
vglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdp

Sequence, based on observed residues (ATOM records): (download)

>d5j26a1 b.34.9.1 (A:1487-1537) p53-binding protein 1, 53BP1 {Human (Homo sapiens) [TaxId: 9606]}
vglrvvakwssngyfysgkitrdvkykllfddgyecdvlgkdillcdp

SCOPe Domain Coordinates for d5j26a1:

Click to download the PDB-style file with coordinates for d5j26a1.
(The format of our PDB-style files is described here.)

Timeline for d5j26a1:

  • d5j26a1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5j26a2
View in 3D
Domains from other chains:
(mouse over for more information)
d5j26b_