Lineage for d5hz8a1 (5hz8 A:1-132)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062521Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2062522Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2063049Family b.60.1.2: Fatty acid binding protein-like [50847] (18 protein domains)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2063324Protein automated matches [190295] (6 species)
    not a true protein
  7. 2063340Species Human (Homo sapiens) [TaxId:9606] [187133] (56 PDB entries)
  8. 2283853Domain d5hz8a1: 5hz8 A:1-132 [327154]
    Other proteins in same PDB: d5hz8a2
    automated match to d5bvqa_
    complexed with 65z, dms

Details for d5hz8a1

PDB Entry: 5hz8 (more details), 1.12 Å

PDB Description: fabp4_3 in complex with 6,8-dichloro-4-phenyl-2-piperidin-1-yl- quinoline-3-carboxylic acid
PDB Compounds: (A:) Fatty acid-binding protein, adipocyte

SCOPe Domain Sequences for d5hz8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hz8a1 b.60.1.2 (A:1-132) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mcdafvgtwklvssenfddymkelgvgfatrkvagmakpntiisvngdvitlktestfkn
teisfilgqefdevtaddrkvkstitldggvlvhvqkwdgksttlkrkreddklvlelvm
kgvtctrvyera

SCOPe Domain Coordinates for d5hz8a1:

Click to download the PDB-style file with coordinates for d5hz8a1.
(The format of our PDB-style files is described here.)

Timeline for d5hz8a1:

  • d5hz8a1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5hz8a2