Lineage for d5gpie_ (5gpi E:)

  1. Root: SCOPe 2.06
  2. 2229111Class g: Small proteins [56992] (94 folds)
  3. 2237459Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily)
  4. 2237460Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families) (S)
    Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex
  5. 2281084Family g.96.1.0: automated matches [324385] (1 protein)
    not a true family
  6. 2281085Protein automated matches [324386] (2 species)
    not a true protein
  7. 2283836Species Zika virus [TaxId:64320] [327137] (3 PDB entries)
  8. 2283850Domain d5gpie_: 5gpi E: [327151]
    Other proteins in same PDB: d5gpib_, d5gpid_, d5gpif_, d5gpih_
    automated match to d2ggva_

Details for d5gpie_

PDB Entry: 5gpi (more details), 1.58 Å

PDB Description: crystal structures of unlinked ns2b-ns3 protease from zika virus and its complex with a reverse peptide inhibitor
PDB Compounds: (E:) NS2B cofactor

SCOPe Domain Sequences for d5gpie_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gpie_ g.96.1.0 (E:) automated matches {Zika virus [TaxId: 64320]}
dmyieragditwekdaevtgnsprldvaldesgdfslv

SCOPe Domain Coordinates for d5gpie_:

Click to download the PDB-style file with coordinates for d5gpie_.
(The format of our PDB-style files is described here.)

Timeline for d5gpie_:

  • d5gpie_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-15