SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gpih_ (5gpi H:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2057706Family b.47.1.3: Viral proteases [50596] (5 protein domains)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 2057796Protein automated matches [190658] (6 species)
    not a true protein
  7. 2283828Species Zika virus [TaxId:64320] [327129] (2 PDB entries)
  8. 2283849Domain d5gpih_: 5gpi H: [327150]
    Other proteins in same PDB: d5gpia_, d5gpic_, d5gpie_, d5gpig_
    automated match to d3e90b_

Details for d5gpih_

PDB Entry: 5gpi (more details), 1.58 Å

PDB Description: crystal structures of unlinked ns2b-ns3 protease from zika virus and its complex with a reverse peptide inhibitor
PDB Compounds: (H:) NS3 protease

SCOPe Domain Sequences for d5gpih_:

Sequence, based on SEQRES records: (download)

>d5gpih_ b.47.1.3 (H:) automated matches {Zika virus [TaxId: 64320]}
evkkgettdgvyrvmtrrllgstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgd
vkqdlvsycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldyp
agtsgspildkcgrviglygngvvikngsyvsaitqgkr

Sequence, based on observed residues (ATOM records): (download)

>d5gpih_ b.47.1.3 (H:) automated matches {Zika virus [TaxId: 64320]}
evkkgettdgvyrvmttqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdlv
sycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsgs
pildkcgrviglygngvvikngsyvsaitqgkr

SCOPe Domain Coordinates for d5gpih_:

Click to download the PDB-style file with coordinates for d5gpih_.
(The format of our PDB-style files is described here.)

Timeline for d5gpih_:

  • d5gpih_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-15