SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hrsa_ (5hrs A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124026Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 protein domains)
  6. 2124027Protein Retroviral integrase, catalytic domain [53108] (4 species)
  7. 2124033Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (52 PDB entries)
  8. 2283847Domain d5hrsa_: 5hrs A: [327148]
    automated match to d3vq9c_
    protein/DNA complex; complexed with 65p, cac, edo, so4; mutant

Details for d5hrsa_

PDB Entry: 5hrs (more details), 1.86 Å

PDB Description: hiv integrase catalytic domain containing f185k + a124n + t125a mutations complexed with gsk0002
PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d5hrsa_:

Sequence, based on SEQRES records: (download)

>d5hrsa_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktiht
dngsnftsnavkaacwwagikqefgipynpqsqgvvesmnkelkkiigqvrdqaehlkta
vqmavfihnkkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records): (download)

>d5hrsa_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktiht
dngsnftsnavkaacwwagikqgvvesmnkelkkiigqvrdqaehlktavqmavfihnkk
rkgysagerivdiiatdiq

SCOPe Domain Coordinates for d5hrsa_:

Click to download the PDB-style file with coordinates for d5hrsa_.
(The format of our PDB-style files is described here.)

Timeline for d5hrsa_:

  • d5hrsa_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-15