SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hz6a1 (5hz6 A:4-132)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2062521Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2062522Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2063049Family b.60.1.2: Fatty acid binding protein-like [50847] (18 protein domains)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2063324Protein automated matches [190295] (6 species)
    not a true protein
  7. 2063340Species Human (Homo sapiens) [TaxId:9606] [187133] (54 PDB entries)
  8. 2283839Domain d5hz6a1: 5hz6 A:4-132 [327140]
    Other proteins in same PDB: d5hz6a2
    automated match to d1pmpa_
    complexed with 65y

Details for d5hz6a1

PDB Entry: 5hz6 (more details), 1.14 Å

PDB Description: fabp4 in complex with 6-chloro-2-isopropyl-4-(3-isopropyl-phenyl)- quinoline-3-carboxylic acid
PDB Compounds: (A:) Fatty acid-binding protein, adipocyte

SCOPe Domain Sequences for d5hz6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hz6a1 b.60.1.2 (A:4-132) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngdvitiksestfkntei
sfilgqefdevtaddrkvkstitldggvlvhvqkwdgksttikrkreddklvvecvmkgv
tstrvyera

SCOPe Domain Coordinates for d5hz6a1:

Click to download the PDB-style file with coordinates for d5hz6a1.
(The format of our PDB-style files is described here.)

Timeline for d5hz6a1:

  • d5hz6a1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5hz6a2