Lineage for d5hrpa_ (5hrp A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124026Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 protein domains)
  6. 2124027Protein Retroviral integrase, catalytic domain [53108] (4 species)
  7. 2124033Species Human immunodeficiency virus type 1 [TaxId:11676] [53110] (53 PDB entries)
  8. 2283833Domain d5hrpa_: 5hrp A: [327134]
    automated match to d3vq9c_
    protein/DNA complex; complexed with 65p, cac, edo, so4; mutant

Details for d5hrpa_

PDB Entry: 5hrp (more details), 1.81 Å

PDB Description: hiv integrase catalytic domain containing f185k + a124t mutations complexed with gsk0002
PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d5hrpa_:

Sequence, based on SEQRES records: (download)

>d5hrpa_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktiht
dngsnftsttvkaacwwagikqefgipynpqsqgvvesmnkelkkiigqvrdqaehlkta
vqmavfihnkkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records): (download)

>d5hrpa_ c.55.3.2 (A:) Retroviral integrase, catalytic domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
cspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktiht
dngsnftsttvkaacwwagikqgvvesmnkelkkiigqvrdqaehlktavqmavfihnkk
rkgysagerivdiiatdiq

SCOPe Domain Coordinates for d5hrpa_:

Click to download the PDB-style file with coordinates for d5hrpa_.
(The format of our PDB-style files is described here.)

Timeline for d5hrpa_:

  • d5hrpa_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-15