Lineage for d5h2xa_ (5h2x A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006450Protein automated matches [190070] (4 species)
    not a true protein
  7. 2283825Species Saccharomyces cerevisiae [TaxId:559292] [327126] (2 PDB entries)
  8. 2283827Domain d5h2xa_: 5h2x A: [327128]
    automated match to d2c1ta_

Details for d5h2xa_

PDB Entry: 5h2x (more details), 2.2 Å

PDB Description: crystal structure of the karyopherin kap60p bound to the sumo protease ulp1p (150-172)
PDB Compounds: (A:) importin subunit alpha

SCOPe Domain Sequences for d5h2xa_:

Sequence, based on SEQRES records: (download)

>d5h2xa_ a.118.1.1 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
elpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpeml
qleaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdy
rdyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliy
smdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgniv
tgndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlipp
lvkllevaeyktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriiev
tldalenilkmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiiet
yfg

Sequence, based on observed residues (ATOM records): (download)

>d5h2xa_ a.118.1.1 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
elpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpeml
qleaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdy
rdyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliy
smdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgniv
tgndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlipp
lvkllevaeyktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriiev
tldalenilkmgeadkeanenadfiekaggmekifncqqnendkiyekaykiietyfg

SCOPe Domain Coordinates for d5h2xa_:

Click to download the PDB-style file with coordinates for d5h2xa_.
(The format of our PDB-style files is described here.)

Timeline for d5h2xa_:

  • d5h2xa_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-15