SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h2xa_ (5h2x A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006450Protein automated matches [190070] (4 species)
    not a true protein
  7. 2283825Species Saccharomyces cerevisiae [TaxId:559292] [327126] (2 PDB entries)
  8. 2283827Domain d5h2xa_: 5h2x A: [327128]
    automated match to d2c1ta_

Details for d5h2xa_

PDB Entry: 5h2x (more details), 2.2 Å

PDB Description: crystal structure of the karyopherin kap60p bound to the sumo protease ulp1p (150-172)
PDB Compounds: (A:) importin subunit alpha

SCOPe Domain Sequences for d5h2xa_:

Sequence, based on SEQRES records: (download)

>d5h2xa_ a.118.1.1 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
elpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpeml
qleaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdy
rdyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliy
smdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgniv
tgndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlipp
lvkllevaeyktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriiev
tldalenilkmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiiet
yfg

Sequence, based on observed residues (ATOM records): (download)

>d5h2xa_ a.118.1.1 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
elpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpeml
qleaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdy
rdyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliy
smdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgniv
tgndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlipp
lvkllevaeyktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriiev
tldalenilkmgeadkeanenadfiekaggmekifncqqnendkiyekaykiietyfg

SCOPe Domain Coordinates for d5h2xa_:

Click to download the PDB-style file with coordinates for d5h2xa_.
(The format of our PDB-style files is described here.)

Timeline for d5h2xa_:

  • d5h2xa_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-15