Lineage for d5h2wa_ (5h2w A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006338Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 2006450Protein automated matches [190070] (4 species)
    not a true protein
  7. 2283825Species Saccharomyces cerevisiae [TaxId:559292] [327126] (3 PDB entries)
  8. 2283826Domain d5h2wa_: 5h2w A: [327127]
    automated match to d2c1ta_

Details for d5h2wa_

PDB Entry: 5h2w (more details), 2.5 Å

PDB Description: crystal structure of the karyopherin kap60p bound to the sumo protease ulp1p (150-340)
PDB Compounds: (A:) importin subunit alpha

SCOPe Domain Sequences for d5h2wa_:

Sequence, based on SEQRES records: (download)

>d5h2wa_ a.118.1.1 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
lpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpemlq
leaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdyr
dyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliys
mdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgnivt
gndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlippl
vkllevaeyktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriievt
ldalenilkmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiiety
f

Sequence, based on observed residues (ATOM records): (download)

>d5h2wa_ a.118.1.1 (A:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
lpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpemlq
leaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdyr
dyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliys
mdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgnivt
gndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlippl
vkllevaeyktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriievt
ldalenilkmgeadkeanenadfiekaggmekifncqqnendkiyekaykiietyf

SCOPe Domain Coordinates for d5h2wa_:

Click to download the PDB-style file with coordinates for d5h2wa_.
(The format of our PDB-style files is described here.)

Timeline for d5h2wa_:

  • d5h2wa_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-15

View in 3D
Domains from other chains:
(mouse over for more information)
d5h2wc_