Lineage for d5b1ob_ (5b1o B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2318503Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 2318543Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families) (S)
  5. 2318544Family a.30.2.1: Homodimeric domain of signal transducing histidine kinase [47385] (4 protein domains)
  6. 2318556Protein automated matches [327108] (1 species)
    not a true protein
  7. 2318557Species Escherichia coli [TaxId:562] [327109] (2 PDB entries)
  8. 2318560Domain d5b1ob_: 5b1o B: [327110]
    Other proteins in same PDB: d5b1oa2
    automated match to d1joya_
    mutant

Details for d5b1ob_

PDB Entry: 5b1o (more details), 2.3 Å

PDB Description: dhp domain structure of envz p248a mutant
PDB Compounds: (B:) Osmolarity sensor protein EnvZ

SCOPe Domain Sequences for d5b1ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1ob_ a.30.2.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
qladdrtllmagvshdlrtaltrirlatemmseqdgylaesinkdieecnaiieqfid

SCOPe Domain Coordinates for d5b1ob_:

Click to download the PDB-style file with coordinates for d5b1ob_.
(The format of our PDB-style files is described here.)

Timeline for d5b1ob_: