![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.30: ROP-like [47379] (8 superfamilies) 4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist |
![]() | Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families) ![]() |
![]() | Family a.30.2.1: Homodimeric domain of signal transducing histidine kinase [47385] (4 protein domains) |
![]() | Protein automated matches [327108] (1 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [327109] (2 PDB entries) |
![]() | Domain d5b1ob_: 5b1o B: [327110] Other proteins in same PDB: d5b1oa2 automated match to d1joya_ mutant |
PDB Entry: 5b1o (more details), 2.3 Å
SCOPe Domain Sequences for d5b1ob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b1ob_ a.30.2.1 (B:) automated matches {Escherichia coli [TaxId: 562]} qladdrtllmagvshdlrtaltrirlatemmseqdgylaesinkdieecnaiieqfid
Timeline for d5b1ob_: