SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b7pb_ (5b7p B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2125403Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2126300Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2126301Protein automated matches [190781] (41 species)
    not a true protein
  7. 2283803Species Aeromonas hydrophila [TaxId:380703] [327104] (4 PDB entries)
  8. 2283806Domain d5b7pb_: 5b7p B: [327107]
    automated match to d4qeza_
    complexed with mta

Details for d5b7pb_

PDB Entry: 5b7p (more details), 1.49 Å

PDB Description: structures and functional analysis of periplasmic 5- methylthioadenosine/s-adenosylhomocysteine nucleosidase from aeromonas hydrophila
PDB Compounds: (B:) MTA/SAH nucleosidase

SCOPe Domain Sequences for d5b7pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b7pb_ c.56.2.0 (B:) automated matches {Aeromonas hydrophila [TaxId: 380703]}
sapiliqgamdvevetlvaalkdkqeltvgswtywqgtlsgypvvvsrtevglanaaaat
tlamerfqprlvinqgtagghdpalhrgdivigtksfnmgayrsdltpaeqgvdpskwhn
fevtmrlrdngklvehssfagdpelvgralgmadryrhgrvvpgiigtadewnrqvarin
wlhqtyqtaaeemetssaalvaeaykvpfvgirvlsntdlhgeefdpqtaihcqqfvidy
akalingf

SCOPe Domain Coordinates for d5b7pb_:

Click to download the PDB-style file with coordinates for d5b7pb_.
(The format of our PDB-style files is described here.)

Timeline for d5b7pb_:

  • d5b7pb_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-15