SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b1ea_ (5b1e A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114950Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2114951Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2114952Family c.41.1.1: Subtilases [52744] (14 protein domains)
  6. 2114990Protein Proteinase K [52762] (1 species)
  7. 2114991Species Fungus (Tritirachium album), strain limber [TaxId:37998] [52763] (37 PDB entries)
    Uniprot P06873
  8. 2283804Domain d5b1ea_: 5b1e A: [327105]
    automated match to d1ic6a_
    complexed with ca

Details for d5b1ea_

PDB Entry: 5b1e (more details), 2.3 Å

PDB Description: crystal structure of proteinase k from engyodontium album
PDB Compounds: (A:) Proteinase K

SCOPe Domain Sequences for d5b1ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1ea_ c.41.1.1 (A:) Proteinase K {Fungus (Tritirachium album), strain limber [TaxId: 37998]}
aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
gasdrydrrssfsnygsvldifgpgtdilstwiggstrsisgtsmatphvaglaaylmtl
gkttaasacryiadtankgdlsnipfgtvnllaynnyqa

SCOPe Domain Coordinates for d5b1ea_:

Click to download the PDB-style file with coordinates for d5b1ea_.
(The format of our PDB-style files is described here.)

Timeline for d5b1ea_:

  • d5b1ea_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-15