Lineage for d5ltra_ (5ltr A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2165335Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2165336Protein automated matches [190526] (21 species)
    not a true protein
  7. 2165337Species Amphioxus (Branchiostoma lanceolatum) [TaxId:7740] [227942] (7 PDB entries)
  8. 2283800Domain d5ltra_: 5ltr A: [327101]
    automated match to d3neda_
    complexed with cl

Details for d5ltra_

PDB Entry: 5ltr (more details), 1.21 Å

PDB Description: structure of the yellow-green fluorescent protein mneongreen from branchiostoma lanceolatum at the near physiological ph 8.0
PDB Compounds: (A:) mNeonGreen

SCOPe Domain Sequences for d5ltra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ltra_ d.22.1.0 (A:) automated matches {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}
nmaslpathelhifgsingvdfdmvgqgtgnpndgyeelnlkstkgdlqfspwilvphig
ygfhqylpypdgmspfqaamvdgsgyqvhrtmqfedgasltvnyrytyegshikgeaqvk
gtgfpadgpvmtnsltaadwcrskktypndktiistfkwsyttgngkryrstarttytfa
kpmaanylknqpmyvfrktelkhsktelnfkewqkaftd

SCOPe Domain Coordinates for d5ltra_:

Click to download the PDB-style file with coordinates for d5ltra_.
(The format of our PDB-style files is described here.)

Timeline for d5ltra_:

  • d5ltra_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08