Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (16 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187331] (21 PDB entries) |
Domain d5m62a1: 5m62 A:194-327 [327094] Other proteins in same PDB: d5m62a2, d5m62b2 automated match to d4cajb_ complexed with bgc, ca, glc, gol, p6g |
PDB Entry: 5m62 (more details), 1.7 Å
SCOPe Domain Sequences for d5m62a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m62a1 d.169.1.0 (A:194-327) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ilemvargwkyfsgnfyyfsrtpktwysaeqfcisrkahltsvsseseqkflykaadgip hwigltkagsegdwywvdqtsfnkeqsrrfwipgepnnagnnehcanirvsalkswndgp cdntflfickrpyv
Timeline for d5m62a1: