SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5f1ga1 (5f1g A:2-360)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2217742Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 protein domains)
  6. 2217756Protein AMPC beta-Lactamase, class C [56618] (4 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 2217797Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (98 PDB entries)
  8. 2283789Domain d5f1ga1: 5f1g A:2-360 [327090]
    Other proteins in same PDB: d5f1ga2
    automated match to d2hdsa_
    complexed with amp, edo, so4

Details for d5f1ga1

PDB Entry: 5f1g (more details), 1.76 Å

PDB Description: crystal structure of a class c beta lactamase
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5f1ga1:

Sequence, based on SEQRES records: (download)

>d5f1ga1 e.3.1.1 (A:2-360) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
pqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelgs
vsktftgvlggdaiargeiklsdpatkywpeltakqwngitllhlatytagglplqvpde
vksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplkl
nhtwinvpppeeknyawgyregkavhvspgaldaeaygvkstiedmarwvrsnmnprdin
dktlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsgnkialaaaahpvkait
pptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvaaawqilnalq

Sequence, based on observed residues (ATOM records): (download)

>d5f1ga1 e.3.1.1 (A:2-360) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
pqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelgs
vsktftgvlggdaiargeiklsdpatkywpeltakqwngitllhlatytagglplqvpde
vksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplkl
nhtwinvpppeeknyawgyregkavhvspgaldaeaygvkstiedmarwvrsnmnprdin
dktlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiinaahpvkaitpptpavrasw
vhktgatggfgsyvafipekelgivmlanknypnparvaaawqilnalq

SCOPe Domain Coordinates for d5f1ga1:

Click to download the PDB-style file with coordinates for d5f1ga1.
(The format of our PDB-style files is described here.)

Timeline for d5f1ga1:

  • d5f1ga1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5f1ga2