Lineage for d5f1ga1 (5f1g A:2-360)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2217742Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 protein domains)
  6. 2217756Protein AMPC beta-Lactamase, class C [56618] (4 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 2217797Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (101 PDB entries)
  8. 2283789Domain d5f1ga1: 5f1g A:2-360 [327090]
    Other proteins in same PDB: d5f1ga2
    automated match to d2hdsa_
    complexed with amp, edo, so4

Details for d5f1ga1

PDB Entry: 5f1g (more details), 1.76 Å

PDB Description: crystal structure of a class c beta lactamase
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5f1ga1:

Sequence, based on SEQRES records: (download)

>d5f1ga1 e.3.1.1 (A:2-360) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
pqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelgs
vsktftgvlggdaiargeiklsdpatkywpeltakqwngitllhlatytagglplqvpde
vksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplkl
nhtwinvpppeeknyawgyregkavhvspgaldaeaygvkstiedmarwvrsnmnprdin
dktlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsgnkialaaaahpvkait
pptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvaaawqilnalq

Sequence, based on observed residues (ATOM records): (download)

>d5f1ga1 e.3.1.1 (A:2-360) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
pqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelgs
vsktftgvlggdaiargeiklsdpatkywpeltakqwngitllhlatytagglplqvpde
vksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplkl
nhtwinvpppeeknyawgyregkavhvspgaldaeaygvkstiedmarwvrsnmnprdin
dktlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiinaahpvkaitpptpavrasw
vhktgatggfgsyvafipekelgivmlanknypnparvaaawqilnalq

SCOPe Domain Coordinates for d5f1ga1:

Click to download the PDB-style file with coordinates for d5f1ga1.
(The format of our PDB-style files is described here.)

Timeline for d5f1ga1:

  • d5f1ga1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5f1ga2