Lineage for d5f06b2 (5f06 B:82-214)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1997413Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1997414Protein automated matches [226831] (61 species)
    not a true protein
  7. 2283560Species Populus trichocarpa [TaxId:3694] [326861] (6 PDB entries)
  8. 2283785Domain d5f06b2: 5f06 B:82-214 [327086]
    Other proteins in same PDB: d5f06a1, d5f06b1
    automated match to d1aw9a1
    complexed with gsh, so4

Details for d5f06b2

PDB Entry: 5f06 (more details), 1.8 Å

PDB Description: crystal structure of glutathione transferase f7 from populus trichocarpa
PDB Compounds: (B:) Glutathione S-transferase family protein

SCOPe Domain Sequences for d5f06b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f06b2 a.45.1.0 (B:82-214) automated matches {Populus trichocarpa [TaxId: 3694]}
gydlirhenlkeaasvkvwteveshrynpaiapivfqfmvaplrgnspdqtiiddnvekl
gkvldiyeaklsstkylagdfysladlhhlpytyylmktpaasvvnerphvkawwediss
rpafkkvaegmnf

SCOPe Domain Coordinates for d5f06b2:

Click to download the PDB-style file with coordinates for d5f06b2.
(The format of our PDB-style files is described here.)

Timeline for d5f06b2:

  • d5f06b2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5f06b1