Lineage for d5f06b1 (5f06 B:2-81)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880525Species Western balsam poplar (Populus trichocarpa) [TaxId:3694] [186776] (13 PDB entries)
  8. 2880536Domain d5f06b1: 5f06 B:2-81 [327085]
    Other proteins in same PDB: d5f06a2, d5f06b2
    automated match to d1aw9a2
    complexed with gsh, so4

Details for d5f06b1

PDB Entry: 5f06 (more details), 1.8 Å

PDB Description: crystal structure of glutathione transferase f7 from populus trichocarpa
PDB Compounds: (B:) Glutathione S-transferase family protein

SCOPe Domain Sequences for d5f06b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f06b1 c.47.1.0 (B:2-81) automated matches {Western balsam poplar (Populus trichocarpa) [TaxId: 3694]}
vlklygapmstctsrvltclheknldfelvpvdlfagehkqppflaknpfgqipaleedd
ltlfesraitsyiaekfkgt

SCOPe Domain Coordinates for d5f06b1:

Click to download the PDB-style file with coordinates for d5f06b1.
(The format of our PDB-style files is described here.)

Timeline for d5f06b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5f06b2