SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5f2qg_ (5f2q G:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208774Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2208775Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2208776Family d.169.1.1: C-type lectin domain [56437] (29 protein domains)
    Pfam PF00059
  6. 2209209Protein automated matches [190329] (9 species)
    not a true protein
  7. 2283562Species Bothrops jararacussu [TaxId:8726] [326863] (1 PDB entry)
  8. 2283781Domain d5f2qg_: 5f2q G: [327082]
    automated match to d1jzna_
    complexed with ca, na

Details for d5f2qg_

PDB Entry: 5f2q (more details), 2.95 Å

PDB Description: c-type lectin from bothrops jararacussu
PDB Compounds: (G:) C-type lectin BJcuL

SCOPe Domain Sequences for d5f2qg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f2qg_ d.169.1.1 (G:) automated matches {Bothrops jararacussu [TaxId: 8726]}
ncpqdwlpmnglcykifnelkawkdaemfcrkykpgchlasihlygespeiaeyisdyhk
gqsevwiglcdkkkdfswewtdrsctdylswdknqpdhyqnkefcvelvsntgyrlwndq
vcesknaflcqckf

SCOPe Domain Coordinates for d5f2qg_:

Click to download the PDB-style file with coordinates for d5f2qg_.
(The format of our PDB-style files is described here.)

Timeline for d5f2qg_:

  • d5f2qg_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08