SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lk4a_ (5lk4 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2164733Family d.22.1.1: Fluorescent proteins [54512] (6 protein domains)
  6. 2165015Protein automated matches [190406] (17 species)
    not a true protein
  7. 2165084Species Coral (Discosoma sp.) [TaxId:86600] [188539] (21 PDB entries)
  8. 2283780Domain d5lk4a_: 5lk4 A: [327081]
    automated match to d3lf3a_
    complexed with peg, pg4, pge, po4

Details for d5lk4a_

PDB Entry: 5lk4 (more details), 1.47 Å

PDB Description: structure of the red fluorescent protein mscarlet at ph 7.8
PDB Compounds: (A:) mScarlet

SCOPe Domain Sequences for d5lk4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lk4a_ d.22.1.1 (A:) automated matches {Coral (Discosoma sp.) [TaxId: 86600]}
avikefmrfkvhmegsmnghefeiegegegrpyegtqtaklkvtkggplpfswdilspqf
mygsraftkhpadipdyykqsfpegfkwervmnfedggavtvtqdtsledgtliykvklr
gtnfppdgpvmqkktmgweasterlypedgvlkgdikmalrlkdggryladfkttykakk
pvqmpgaynvdrklditshnedytvveqyersegrhstg

SCOPe Domain Coordinates for d5lk4a_:

Click to download the PDB-style file with coordinates for d5lk4a_.
(The format of our PDB-style files is described here.)

Timeline for d5lk4a_:

  • d5lk4a_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08