Lineage for d5ltqh_ (5ltq H:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2165335Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2165336Protein automated matches [190526] (21 species)
    not a true protein
  7. 2165337Species Amphioxus (Branchiostoma lanceolatum) [TaxId:7740] [227942] (7 PDB entries)
  8. 2283774Domain d5ltqh_: 5ltq H: [327075]
    Other proteins in same PDB: d5ltqa2, d5ltqb2, d5ltqc2, d5ltqd2, d5ltqf2, d5ltqj2, d5ltql2, d5ltqn2, d5ltqp2
    automated match to d4jgea_
    complexed with cl

Details for d5ltqh_

PDB Entry: 5ltq (more details), 2.05 Å

PDB Description: structure of the yellow fluorescent protein lanyfp from branchiostoma lanceolatum at ph 7.5
PDB Compounds: (H:) Green fluorescent protein blFP-Y3

SCOPe Domain Sequences for d5ltqh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ltqh_ d.22.1.0 (H:) automated matches {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}
lpathelhifgsfngvdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygfh
qylpfpdgmspfqaamkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtgf
padgpvmtnsltaadwcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpma
anilknqpmfvfrktelkhsktelnfkewqkaftdvm

SCOPe Domain Coordinates for d5ltqh_:

Click to download the PDB-style file with coordinates for d5ltqh_.
(The format of our PDB-style files is described here.)

Timeline for d5ltqh_:

  • d5ltqh_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08