SCOPe 2.08: Domain d2nb1a1: 2nb1 A:2-60

Lineage for d2nb1a1 (2nb1 A:2-60)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.53: p53 tetramerization domain [47718] (1 superfamily)
   core: 4 helices; bundle

4. Superfamily a.53.1: p53 tetramerization domain [47719] (2 families)
   homotetramer

5. Family a.53.1.0: automated matches [259188] (1 protein)
   not a true family

6. Protein automated matches [259190] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [311354] (9 PDB entries)

8. Domain d2nb1a1: 2nb1 A:2-60 [327071]
   Other proteins in same PDB: d2nb1a2, d2nb1b2, d2nb1c2, d2nb1d2
   automated match to d3zy1a_

Details for d2nb1a1

PDB Entry: 2nb1

PDB Description: p63/p73 hetero-tetramerisation domain

PDB Compounds: (A:) Tumor protein 63

SCOPe Domain Sequences for d2nb1a1:

Sequence; same for both SEQRES and ATOM records:

>d2nb1a1 a.53.1.0 (A:2-60) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddellylpvrgretyemlleikeslelmqylpqhtietyrqqqqqqhqhllqkqtsiqs

Timeline for d2nb1a1:

• d2nb1a1 first appeared in SCOPe 2.06
  
• d2nb1a1 appears in SCOPe 2.07