SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ltqb1 (5ltq B:2-219)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2164731Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2164732Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2165335Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2165336Protein automated matches [190526] (21 species)
    not a true protein
  7. 2165337Species Amphioxus (Branchiostoma lanceolatum) [TaxId:7740] [227942] (7 PDB entries)
  8. 2283763Domain d5ltqb1: 5ltq B:2-219 [327064]
    Other proteins in same PDB: d5ltqa2, d5ltqb2, d5ltqc2, d5ltqd2, d5ltqf2, d5ltqj2, d5ltql2, d5ltqn2, d5ltqp2
    automated match to d4jgea_
    complexed with cl

Details for d5ltqb1

PDB Entry: 5ltq (more details), 2.05 Å

PDB Description: structure of the yellow fluorescent protein lanyfp from branchiostoma lanceolatum at ph 7.5
PDB Compounds: (B:) Green fluorescent protein blFP-Y3

SCOPe Domain Sequences for d5ltqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ltqb1 d.22.1.0 (B:2-219) automated matches {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]}
slpathelhifgsfngvdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygf
hqylpfpdgmspfqaamkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtg
fpadgpvmtnsltaadwcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpm
aanilknqpmfvfrktelkhsktelnfkewqkaftdvm

SCOPe Domain Coordinates for d5ltqb1:

Click to download the PDB-style file with coordinates for d5ltqb1.
(The format of our PDB-style files is described here.)

Timeline for d5ltqb1:

  • d5ltqb1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08