Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (26 species) not a true protein |
Species Amphioxus (Branchiostoma lanceolatum) [TaxId:7740] [227942] (7 PDB entries) |
Domain d5ltqp1: 5ltq P:2-219 [327062] Other proteins in same PDB: d5ltqa2, d5ltqb2, d5ltqc2, d5ltqd2, d5ltqf2, d5ltqj2, d5ltql2, d5ltqn2, d5ltqp2 automated match to d4jgea_ complexed with cl |
PDB Entry: 5ltq (more details), 2.05 Å
SCOPe Domain Sequences for d5ltqp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ltqp1 d.22.1.0 (P:2-219) automated matches {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} slpathelhifgsfngvdfdmvgrgtgnpndgyeelnlkstkgalqfspwilvpqigygf hqylpfpdgmspfqaamkdgsgyqvhrtmqfedgasltsnyrytyegshikgefqvigtg fpadgpvmtnsltaadwcvtkmlypndktiistfdwtyttgsgkryqstarttytfakpm aanilknqpmfvfrktelkhsktelnfkewqkaftdvm
Timeline for d5ltqp1: