SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5exff_ (5exf F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (42 species)
    not a true protein
  7. 2141521Species Pyrobaculum sp. [TaxId:1104324] [228031] (9 PDB entries)
  8. 2283760Domain d5exff_: 5exf F: [327061]
    automated match to d4nmkc_
    complexed with gol, nap

Details for d5exff_

PDB Entry: 5exf (more details), 2.19 Å

PDB Description: thermostable aldehyde dehydrogenase from pyrobaculum sp.1860 complexed with nadp+
PDB Compounds: (F:) aldehyde dehydrogenase

SCOPe Domain Sequences for d5exff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5exff_ c.82.1.0 (F:) automated matches {Pyrobaculum sp. [TaxId: 1104324]}
idlnimkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealka
wanipairraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaela
rhyqgrvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpas
dtpvtgwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaa
kaagtlktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavad
kfieryvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswg
nffepaifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnr
afriaeavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrt
rrfpipsa

SCOPe Domain Coordinates for d5exff_:

Click to download the PDB-style file with coordinates for d5exff_.
(The format of our PDB-style files is described here.)

Timeline for d5exff_:

  • d5exff_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08