SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5f6fa1 (5f6f A:2-139)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983660Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1983661Protein automated matches [190154] (64 species)
    not a true protein
  7. 1983986Species Staphylococcus aureus [TaxId:1280] [193082] (9 PDB entries)
  8. 2283756Domain d5f6fa1: 5f6f A:2-139 [327057]
    Other proteins in same PDB: d5f6fa2, d5f6fb2
    automated match to d4llla_
    mutant

Details for d5f6fa1

PDB Entry: 5f6f (more details), 1.75 Å

PDB Description: s. aureus mepr g34r mutant
PDB Compounds: (A:) MarR family regulatory protein

SCOPe Domain Sequences for d5f6fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f6fa1 a.4.5.0 (A:2-139) automated matches {Staphylococcus aureus [TaxId: 1280]}
eftysylfrmishemkqkadqkleqfditneqrhtlgylyahqqdgltqndiakalqrtg
ptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklveaftsifdemeqtlvsqlse
eeneqmkanltkmlsslq

SCOPe Domain Coordinates for d5f6fa1:

Click to download the PDB-style file with coordinates for d5f6fa1.
(The format of our PDB-style files is described here.)

Timeline for d5f6fa1:

  • d5f6fa1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5f6fa2