SCOPe 2.06: Domain d5f1fa1: 5f1f A:1-359

Lineage for d5f1fa1 (5f1f A:1-359)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (40 species)
   not a true protein

7. Species Enterobacter aerogenes [TaxId:548] [188190] (5 PDB entries)

8. Domain d5f1fa1: 5f1f A:1-359 [327047]
   Other proteins in same PDB: d5f1fa2
   automated match to d4wz4a_
   complexed with amp, cd

Details for d5f1fa1

PDB Entry: 5f1f, 1.55 Å

PDB Description: crystal structure of cmy-10 adenylylated by acetyl-amp

PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5f1fa1:

Sequence; same for both SEQRES and ATOM records:

>d5f1fa1 e.3.1.0 (A:1-359) automated matches {Enterobacter aerogenes [TaxId: 548]}
geaspvdplrpvvdasiqpllkehripgmavavlkdgkahyfnygvanresgagvseqtl
feigsvsktltatlgayavvkgamqlddkasrhapwlkgsafdsitmgelatysagglpl
qfpeevdssekmrayyrqwapvyspgshrqysnpsiglfghlaasslkqpfaplmeqtll
pglgmhhtyvnvpkqamasyaygyskedkpirvnpgmladeaygiktssadllrfvkani
ggvddkalqqaislthqghysvggmtqglgwesyaypvteqtllagnsakvileanptaa
presgsqvlfnktgstngfgayvafvpargigivmlanrnypiearikaahailaqlag

Timeline for d5f1fa1:

• d5f1fa1 is new in SCOPe 2.06-stable
  
• d5f1fa1 appears in SCOPe 2.07
  
• d5f1fa1 appears in the current release, SCOPe 2.08