SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5f1fa1 (5f1f A:1-359)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2218831Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2218832Protein automated matches [190857] (39 species)
    not a true protein
  7. 2218910Species Enterobacter aerogenes [TaxId:548] [188190] (4 PDB entries)
  8. 2283746Domain d5f1fa1: 5f1f A:1-359 [327047]
    Other proteins in same PDB: d5f1fa2
    automated match to d4wz4a_
    complexed with amp, cd

Details for d5f1fa1

PDB Entry: 5f1f (more details), 1.55 Å

PDB Description: crystal structure of a class c beta lactamase
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5f1fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f1fa1 e.3.1.0 (A:1-359) automated matches {Enterobacter aerogenes [TaxId: 548]}
geaspvdplrpvvdasiqpllkehripgmavavlkdgkahyfnygvanresgagvseqtl
feigsvsktltatlgayavvkgamqlddkasrhapwlkgsafdsitmgelatysagglpl
qfpeevdssekmrayyrqwapvyspgshrqysnpsiglfghlaasslkqpfaplmeqtll
pglgmhhtyvnvpkqamasyaygyskedkpirvnpgmladeaygiktssadllrfvkani
ggvddkalqqaislthqghysvggmtqglgwesyaypvteqtllagnsakvileanptaa
presgsqvlfnktgstngfgayvafvpargigivmlanrnypiearikaahailaqlag

SCOPe Domain Coordinates for d5f1fa1:

Click to download the PDB-style file with coordinates for d5f1fa1.
(The format of our PDB-style files is described here.)

Timeline for d5f1fa1:

  • d5f1fa1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5f1fa2