Lineage for d5f1fa1 (5f1f A:1-359)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2218831Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2218832Protein automated matches [190857] (40 species)
    not a true protein
  7. 2218910Species Enterobacter aerogenes [TaxId:548] [188190] (5 PDB entries)
  8. 2283746Domain d5f1fa1: 5f1f A:1-359 [327047]
    Other proteins in same PDB: d5f1fa2
    automated match to d4wz4a_
    complexed with amp, cd

Details for d5f1fa1

PDB Entry: 5f1f (more details), 1.55 Å

PDB Description: crystal structure of a class c beta lactamase
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d5f1fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f1fa1 e.3.1.0 (A:1-359) automated matches {Enterobacter aerogenes [TaxId: 548]}
geaspvdplrpvvdasiqpllkehripgmavavlkdgkahyfnygvanresgagvseqtl
feigsvsktltatlgayavvkgamqlddkasrhapwlkgsafdsitmgelatysagglpl
qfpeevdssekmrayyrqwapvyspgshrqysnpsiglfghlaasslkqpfaplmeqtll
pglgmhhtyvnvpkqamasyaygyskedkpirvnpgmladeaygiktssadllrfvkani
ggvddkalqqaislthqghysvggmtqglgwesyaypvteqtllagnsakvileanptaa
presgsqvlfnktgstngfgayvafvpargigivmlanrnypiearikaahailaqlag

SCOPe Domain Coordinates for d5f1fa1:

Click to download the PDB-style file with coordinates for d5f1fa1.
(The format of our PDB-style files is described here.)

Timeline for d5f1fa1:

  • d5f1fa1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5f1fa2