SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hpja_ (5hpj A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2067964Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2067965Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2068693Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2068694Protein automated matches [191011] (13 species)
    not a true protein
  7. 2283744Species Photobacterium profundum [TaxId:298386] [327045] (1 PDB entry)
  8. 2283745Domain d5hpja_: 5hpj A: [327046]
    automated match to d4ygfa_
    complexed with cl, zn

Details for d5hpja_

PDB Entry: 5hpj (more details), 1.5 Å

PDB Description: photobacterium profundum alpha-carbonic anhydrase
PDB Compounds: (A:) carbonic anhydrase

SCOPe Domain Sequences for d5hpja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hpja_ b.74.1.0 (A:) automated matches {Photobacterium profundum [TaxId: 298386]}
ewsytgehgtehwgdsfatcaegvnqtpidinqttqaelaplhldyegqvtelvnnghti
qanltgkntltvdgktfelkqfhfhtpsenylkgkqypleahfvhatdkgelavvavmfd
fgprsnnelttllasipskgqtvelkealnpadllprdreyyrfngslttppcsegvrwf
vmqepqtsskaqteklqavmgnnarplqplnarlile

SCOPe Domain Coordinates for d5hpja_:

Click to download the PDB-style file with coordinates for d5hpja_.
(The format of our PDB-style files is described here.)

Timeline for d5hpja_:

  • d5hpja_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08