SCOPe 2.08: Domain d5g4lb1: 5g4l B:1-264

Lineage for d5g4lb1 (5g4l B:1-264)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Clostridium sp. [TaxId:1506] [326919] (2 PDB entries)

8. Domain d5g4lb1: 5g4l B:1-264 [327043]
   Other proteins in same PDB: d5g4la2, d5g4lb2
   automated match to d3i3of_
   complexed with ndp

Details for d5g4lb1

PDB Entry: 5g4l, 1.8 Å

PDB Description: phloroglucinol reductase from clostridium sp. with bound nadph

PDB Compounds: (B:) Oxidoreductase, short chain dehydrogenase/reductase family protein

SCOPe Domain Sequences for d5g4lb1:

Sequence; same for both SEQRES and ATOM records:

>d5g4lb1 c.2.1.0 (B:1-264) automated matches {Clostridium sp. [TaxId: 1506]}
mvnvkkefvdnmfsvkgkvalvtgatgalgcvlskaygyagakvfmtgrnekklqaleae
fkaegidcaygvadpadeaqvdamitacvaqygevnilavthgfnkpqnileqsvadwqy
imdadcksvyvvckyvaqqmvdqgkggkivvvtsqrskrgmagytgyctskggadlmvss
macdlsakyginvnsicptvfrsdltewmfdpesavyqnflkrepigrlaepedfvgyal
flssdasnyitgancdcsggyltc

Timeline for d5g4lb1:

• d5g4lb1 first appeared in SCOPe 2.06
  
• d5g4lb1 appears in SCOPe 2.07