Lineage for d5b11o_ (5b11 O:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2402454Fold b.76: open-sided beta-meander [51086] (2 superfamilies)
    single sheet formed by beta-hairpin repeats; exposed on both sides in the middle
  4. 2402455Superfamily b.76.1: Outer surface protein [51087] (1 family) (S)
    21 stranded sheet partly folded upon itself at the ends
  5. 2402456Family b.76.1.1: Outer surface protein [51088] (3 protein domains)
  6. 2402468Protein automated matches [190440] (2 species)
    not a true protein
  7. 2402469Species Borrelia burgdorferi [TaxId:224326] [326377] (2 PDB entries)
  8. 2402470Domain d5b11o_: 5b11 O: [327040]
    automated match to d3aumo_
    mutant

Details for d5b11o_

PDB Entry: 5b11 (more details), 1.2 Å

PDB Description: a mutation of ospa
PDB Compounds: (O:) Outer surface protein A

SCOPe Domain Sequences for d5b11o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b11o_ b.76.1.1 (O:) automated matches {Borrelia burgdorferi [TaxId: 224326]}
nsvsvdlpgsmkvlvskssnadgkydliatvdalelsgtsdknngsgvlegvkadaskvk
ltisddlgqttlevfksdgstlvskkvtskdkssgeekfnekgevsekiitradgtrley
tgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgavsvelndtdss
aatkktaawnsgtstltitvnskktkdlvftssntitvqqydsngtslegsaveitklde
iknalk

SCOPe Domain Coordinates for d5b11o_:

Click to download the PDB-style file with coordinates for d5b11o_.
(The format of our PDB-style files is described here.)

Timeline for d5b11o_: