SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ez5a_ (5ez5 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (122 species)
    not a true protein
  7. 2114207Species Human (Homo sapiens) [TaxId:9606] [186862] (117 PDB entries)
  8. 2283738Domain d5ez5a_: 5ez5 A: [327039]
    automated match to d4uj3d_
    complexed with gtp, mg

Details for d5ez5a_

PDB Entry: 5ez5 (more details), 2.4 Å

PDB Description: crystal structure of active rab11a (s20v) in complex with gtp
PDB Compounds: (A:) Ras-related protein Rab-11A

SCOPe Domain Sequences for d5ez5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ez5a_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ydylfkvvligdvgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwdt
agqeryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksd
lrhlravptdearafaeknglsfietsaldstnveaafqtilteiyri

SCOPe Domain Coordinates for d5ez5a_:

Click to download the PDB-style file with coordinates for d5ez5a_.
(The format of our PDB-style files is described here.)

Timeline for d5ez5a_:

  • d5ez5a_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08