SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mhba_ (5mhb A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086002Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 protein domains)
    hybrid of classes I and II aldolase
    automatically mapped to Pfam PF00490
  6. 2086040Protein automated matches [190088] (5 species)
    not a true protein
  7. 2283730Species Escherichia coli [TaxId:562] [327031] (1 PDB entry)
  8. 2283731Domain d5mhba_: 5mhb A: [327032]
    automated match to d1l6sa_
    complexed with gol, pbg, zn

Details for d5mhba_

PDB Entry: 5mhb (more details), 2.1 Å

PDB Description: product-complex of e.coli 5-amino laevulinic acid dehydratase
PDB Compounds: (A:) delta-aminolevulinic acid dehydratase

SCOPe Domain Sequences for d5mhba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mhba_ c.1.10.3 (A:) automated matches {Escherichia coli [TaxId: 562]}
tdliqrprrlrkspalramfeettlslndlvlpifveeeiddykaveampgvmripekhl
areierianagirsvmtfgishhtdetgsdawredglvarmsrickqtvpemivmsdtcf
ceytshghcgvlcehgvdndatlenlgkqavvaaaagadfiapsaamdgqvqairqalda
agfkdtaimsystkfassfygpfreaagsalkgdrksyqmnpmnrreaireslldeaqga
dclmvkpagayldivrelrertelpigayqvsgeyamikfaalagaideekvvleslgsi
kragadlifsyfaldlaekkilr

SCOPe Domain Coordinates for d5mhba_:

Click to download the PDB-style file with coordinates for d5mhba_.
(The format of our PDB-style files is described here.)

Timeline for d5mhba_:

  • d5mhba_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08