SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5g4ka_ (5g4k A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (230 species)
    not a true protein
  7. 2283618Species Clostridium sp. [TaxId:1506] [326919] (2 PDB entries)
  8. 2283729Domain d5g4ka_: 5g4k A: [327030]
    automated match to d3i3of_

Details for d5g4ka_

PDB Entry: 5g4k (more details), 1.74 Å

PDB Description: phloroglucinol reductase from clostridium sp. apo-form
PDB Compounds: (A:) Oxidoreductase, short chain dehydrogenase/reductase family protein

SCOPe Domain Sequences for d5g4ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g4ka_ c.2.1.0 (A:) automated matches {Clostridium sp. [TaxId: 1506]}
mvnvkkefvdnmfsvkgkvalvtgatgalgcvlskaygyagakvfmtgrnekklqaleae
fkaegidcaygvadpadeaqvdamitacvaqygevnilavthgfnkpqnileqsvadwqy
imdtdcksvyvvckyvaqqmvdqgkggkivvvtsqrskrgmagytgyctskggadlmvss
macdlsakyginvnsicptvfrsdltewmfdpesavyqnflkrepigrlaepedfvgyal
flssdasnyitgancdcsggyltc

SCOPe Domain Coordinates for d5g4ka_:

Click to download the PDB-style file with coordinates for d5g4ka_.
(The format of our PDB-style files is described here.)

Timeline for d5g4ka_:

  • d5g4ka_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-08

View in 3D
Domains from other chains:
(mouse over for more information)
d5g4kb_