SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5dala2 (5dal A:77-209)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1996614Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 protein domains)
  6. 1996931Protein Class pi GST [81347] (4 species)
  7. 1996932Species Human (Homo sapiens) [TaxId:9606] [47619] (61 PDB entries)
  8. 2283728Domain d5dala2: 5dal A:77-209 [327029]
    Other proteins in same PDB: d5dala1, d5dalb1
    automated match to d13gsa1
    complexed with 5au, gsh, mes, pa0, so4

Details for d5dala2

PDB Entry: 5dal (more details), 1.5 Å

PDB Description: crystal structure of human glutathione transferase pi complexed with a metalloid in the presence of glutathione
PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d5dala2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dala2 a.45.1.1 (A:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOPe Domain Coordinates for d5dala2:

Click to download the PDB-style file with coordinates for d5dala2.
(The format of our PDB-style files is described here.)

Timeline for d5dala2:

  • d5dala2 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5dala1