Lineage for d5dala1 (5dal A:0-76)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2117361Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 protein domains)
  6. 2117676Protein Class pi GST [81358] (4 species)
  7. 2117677Species Human (Homo sapiens) [TaxId:9606] [52864] (59 PDB entries)
  8. 2283727Domain d5dala1: 5dal A:0-76 [327028]
    Other proteins in same PDB: d5dala2, d5dalb2
    automated match to d13gsa2
    complexed with 5au, gsh, mes, pa0, so4

Details for d5dala1

PDB Entry: 5dal (more details), 1.5 Å

PDB Description: crystal structure of human glutathione transferase pi complexed with a metalloid in the presence of glutathione
PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d5dala1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dala1 c.47.1.5 (A:0-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
mppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgd
ltlyqsntilrhlgrtl

SCOPe Domain Coordinates for d5dala1:

Click to download the PDB-style file with coordinates for d5dala1.
(The format of our PDB-style files is described here.)

Timeline for d5dala1:

  • d5dala1 appears in periodic updates to SCOPe 2.06 starting on 2016-12-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5dala2