Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries) |
Domain d5laxa1: 5lax A:2-81 [327025] Other proteins in same PDB: d5laxa2, d5laxa3, d5laxb1, d5laxb2, d5laxb3, d5laxc2, d5laxd1, d5laxd2, d5laxd3 automated match to d1fnga2 complexed with mla |
PDB Entry: 5lax (more details), 2.6 Å
SCOPe Domain Sequences for d5laxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5laxa1 d.19.1.0 (A:2-81) automated matches {Human (Homo sapiens) [TaxId: 9606]} keehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgala niavdkanleimtkrsnytp
Timeline for d5laxa1: